PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015872516.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 684aa    MW: 76145 Da    PI: 5.1127
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015872516.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS254.15.1e-784246841261
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfs 94 
                     l++lL+ cA+avs++d + a++lL+++++++sp+gd  qRla++f+++L+ar+a+  v++ y++l++++ts    ++ l+ +++   ++P+ k+s
  XP_015872516.1 424 LRTLLILCAQAVSANDIRTAHELLKQIRQHSSPSGDGCQRLAHFFANGLEARIAGtGVQTFYSSLASKRTS---AVDILKCYQVHLSAFPFKKMS 515
                     5789***************************************************5556667777777666...9******************** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + aN++Il+ +e+++++Hi+Df+i +G+QWp L+q L+sR++gpp+lRiTg++ p++g   +e++eetg+rLak++e++gvpfe+n+++++++e
  XP_015872516.1 516 MFFANKMILKMAEKATKLHIVDFGILYGFQWPILIQHLSSRSGGPPKLRITGIEIPQPGfrPSERIEETGRRLAKYCERFGVPFEYNAIASQTWE 610
                     **********************************************************9*****************************9999*** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                     ++++eeL+++++E+laVn+ ++ ++llde+v+++ +r++vL+l+++++P+++v    + + n++ F++rf eal
  XP_015872516.1 611 TIQVEELKIDKDEVLAVNSFFRFKNLLDETVEVNCPRNAVLNLIRKMNPNIFVNNVVNGSFNAPFFVTRFREAL 684
                     ************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.354398684IPR005202Transcription factor GRAS
PfamPF035141.8E-75424684IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MIMDPSFTEF SDFTNGFVID KQTVVLPDSN QFPNLLDEYK FDQPSPDLDF MDNYLFFPPH  60
PDSGNFIPSM TVSSEVGSSI PSVSPSPDGS SSGPNSSVSP RGDSSPDESE FSESVIKYIS  120
QILMEEKIEE KPCMFFDPLG LQITEKSFYD VLVGEKNPNS SNQNPVYVDQ TVETHSPNQH  180
PLHFDQTVVG PDDNFSSLSS DNGGSSNSSN GPHWLGDIGD YKPSISPTPL PNDHNFRYNS  240
NHISDFSVPT YSLGDGLSSS SLNELAQNIF RDSDSISQFH RGLEEASKFL PKGNQLIIDL  300
ESSTFSPELK GESPKVVVKE EKSDRETSPN GLRGRKNHER ENIDLEEERS AKQSAVYVDE  360
SDLSDMFDRV LLCTDGNNHC AGSEVVISGT SKSLQPNEQP QGPHGNGGRA RSKKQGKKRE  420
TVDLRTLLIL CAQAVSANDI RTAHELLKQI RQHSSPSGDG CQRLAHFFAN GLEARIAGTG  480
VQTFYSSLAS KRTSAVDILK CYQVHLSAFP FKKMSMFFAN KMILKMAEKA TKLHIVDFGI  540
LYGFQWPILI QHLSSRSGGP PKLRITGIEI PQPGFRPSER IEETGRRLAK YCERFGVPFE  600
YNAIASQTWE TIQVEELKID KDEVLAVNSF FRFKNLLDET VEVNCPRNAV LNLIRKMNPN  660
IFVNNVVNGS FNAPFFVTRF REAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-324286848259GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872516.10.0PREDICTED: scarecrow-like protein 14, partial
SwissprotQ9XE581e-173SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9T6830.0B9T683_RICCO; Transcription factor, putative
STRINGPOPTR_0001s24860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-173SCARECROW-like 14